DPCstruct | MC10537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836TXI2 | 18-95 | FFKNKWKIVFLIMMATMLVDIDHLLANPVYDSNRCSIGFHPLHEIFPILIYSGLCFIKPCRYVGIGLIIHMALDSIDC |
| A0A7U6KNG8 | 20-93 | ILLATMLVDLDHLLATPVFLPDRCSINFHPLHTYYAMAVYAAMLFLPKPYRIIGLGLLLHMLTDSNDCVMTYLN |
| A0A379GSV6 | 1-76 | None |
| A0A3B0V7A5 | 1-69 | None |
| A0A3D9KVV2 | 1-69 | None |
| A0A383EXG1 | 53-128 | None |
| A0A1M7FZS3 | 17-95 | None |
| A0A1Z8KKP0 | 1-62 | None |
| A0A2D4S756 | 35-126 | None |
| A0A1H8FPC5 | 4-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.