DPCstruct | MC10536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4GGY1 | 2-121 | AHNITRSPFPNSKKIYVEGKIHPIHVAMREIQLSPTKLSNGKMDENPPVTIYDTSGPYTDENFEINIEKGLPRIREQWILNRNDVEI… |
| A0A7U6KKQ6 | 2-133 | MHALKKTRATYTVSLPASRKVYIEGSRPDIQVPMREISLTDTPVGGTGDKDGEHNPPFYVYDTSGVYTDPNVEIDLTRGLPKLRENW… |
| X4ZZN4 | 2-118 | None |
| A0A1B0C474 | 38-149 | None |
| A0A376ETM7 | 5-129 | None |
| A0A2R7QBU0 | 3-124 | None |
| A0A379W0F0 | 20-145 | None |
| X0QY72 | 63-181 | None |
| A0A090WWL9 | 9-132 | None |
| A0A6C9IKK8 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.