DPCstruct | MC10534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 169 ± 28 aa |
| Standard deviation of domain lengths | 27.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 13.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9AC37 | 46-197 | SDKEPTQQDIVKKNVEEYLKPKMNDPESYEFVELKLTDSVLYSDNVKYRKEYFEKDLKFEKGELKRQEKYKNEFPSMYSEEKISKLN… |
| A0A7K1SXI0 | 11-160 | LNILTFYSAHAQSNQQKAQGLIIKYLSSKSNLKSNANINFSPIEVLRSSFADTKQYKNLLHKIDTLKLEGRKIDARIPKLKTTAEIN… |
| A0A1Q6IHH5 | 5-166 | None |
| A0A086AXT6 | 12-169 | None |
| A0A219ADC6 | 1-189 | None |
| A0A016I474 | 5-169 | None |
| R5M2Z0 | 3-172 | None |
| A0A1K1P3V6 | 1-205 | None |
| A0A2T4WU08 | 8-145 | None |
| A0A4Q5SNM0 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.