DPCstruct | MC10533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 335 ± 33 aa |
| Standard deviation of domain lengths | 32.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7J4N2 | 1-334 | MKKDQVSANNFLQVYHEIQRADYLQRLPKLEVVQSLSNDGFINNYIPLSLLIADFDNLKANDLETRKVVLNSDNQLELRDGSKDVFD… |
| A0A7K1SVI0 | 1-381 | MKKLLLFLIVFASLTVKAQTPKNFTQTADSCLFNLDKSGVTTGILYDRVFPFAGLAIFNQNYADTSSFTHFKQGYNELYDAAYSNGG… |
| A0A4Z0PNS7 | 23-417 | None |
| A0A2H0ISP6 | 55-387 | None |
| A0A848J751 | 223-572 | None |
| A0A180F0Q4 | 2-324 | None |
| A0A5C7B9H7 | 4-261 | None |
| A0A1F3F3I9 | 28-356 | None |
| A0A1M5CMB4 | 33-402 | None |
| A0A1C3YD59 | 16-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.