DPCstruct | MC10531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0VRA3 | 6-163 | EAALVHYFPALDKTAKKRRPAAKVGERIRAFLDDELEIISDIATKNIFIVNCNGVSFPEAIYKFGRTSIAHEGELDPRLNFNNNSGM… |
| A0A7I7QH02 | 16-196 | KREWDAAMLHACNAVDATGKKRYAKLGVGRRFKATIRDSVDMFGAMAFPNLDLDRMRFPVRVQSNLPDKRPDIADVLYGIHRCSHGH… |
| A0A2V6J6S4 | 1-161 | None |
| A0A5C5VQX9 | 258-408 | None |
| A0A1G4X129 | 3-185 | None |
| A0A1G8M8V0 | 32-208 | None |
| F3YB80 | 31-163 | None |
| A0A7X7TE13 | 1-166 | None |
| A0A3N1AQP4 | 1-142 | None |
| A0A3A0DVW1 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.