DPCstruct | MC1053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 176 ± 21 aa |
| Standard deviation of domain lengths | 21.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8TIZ2 | 94-255 | PTASGDAGRPLVAAGVLRATDEGPVLTPRFGETWSERAAARHATGANEADVAAAFDAESVSRLGDASFVLDGDTSVRWESTAALAAD… |
| A0A1G9UCY8 | 34-188 | EDDSPTETLVDAEVLRPVGDGHVLVDEFGDRWLDSMAPFRDATPEQIADGIRGVRPDATVGVEDRDGRPTLVVTDGWDGGTLELSRA… |
| A0A2R6ENU0 | 1-187 | None |
| A0A830DMP4 | 85-266 | None |
| V4ZJG8 | 1-126 | None |
| V4XSL6 | 86-254 | None |
| A0A6B0HFZ5 | 49-237 | None |
| A0A2Z2HU13 | 29-221 | None |
| A0A1I2QY58 | 55-242 | None |
| A0A2G1WXK3 | 3-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.