DPCstruct | MC10527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 144 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00864 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M4EGT8 | 7-140 | EKVSSFLFEYDTPRMVLVRNKKVGLTFRLIQLVVLGYIIGWVFLYEKGYQSQDGIVSSVSVKLKGLALTNVSGMGPLIWDVADYVFP… |
| A0A212DIP4 | 3-138 | CISDFFTYETTKSVVVKSWTIGIINRAVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGFGRYANRVMDVSDYVTPPQSEEK… |
| A0A4Z2GI03 | 5-156 | None |
| A0A267GC16 | 8-142 | None |
| Q6P5P0 | 6-132 | None |
| A0A6P8FTL5 | 1-122 | None |
| G3I1N5 | 5-121 | None |
| A0A2Y9E1E3 | 315-480 | None |
| B7Z1M5 | 11-131 | None |
| A0A818EQS2 | 24-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.