DPCstruct | MC10526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 3.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 65.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250XUW0 | 1-55 | MATLACRVQFLDDTDPFNSTNFPEPSRPPLFTFREDLALGTQLAGVHRLLRAPHK |
| A0A212DE70 | 13-71 | VSLVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPALHRLLGAPLKAALR |
| F6TI75 | 14-68 | None |
| A0A3P9JB64 | 66-120 | None |
| A0A6A5EVI1 | 1-55 | None |
| A0A672K8W1 | 1-47 | None |
| Q2V2M9 | 1-55 | None |
| A0A673KXB3 | 1-48 | None |
| A0A6G0HSY4 | 1-55 | None |
| A0A819H184 | 374-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.