DPCstruct | MC10525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 162 ± 37 aa |
| Standard deviation of domain lengths | 37.20 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.47 |
| Pfam Score | 78.68 |
| Assigned Pfam label(s) | PF00327- PF08079- CL0445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A556U6I2 | 107-310 | KAAHIKAVQLEKKKRVVTRKLIYSRAQAYHKEYREMYRREIRMNRMARKVGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLR… |
| A0A212CX04 | 27-175 | IRVARMARKAGNFCEPAEPKLAFVIRIRGINGVSPKVLKVLQLLRLRQIFCGTFVKLYKASINMLRIVEPYIAWGYPNLKSVNELIY… |
| A0A0C9UR86 | 36-170 | None |
| A0A4Y9ZF99 | 881-1087 | None |
| A0A835IMI3 | 4-115 | None |
| A0A2H9TH65 | 641-829 | None |
| A0A834TRY5 | 13-164 | None |
| A0A2G3CZE2 | 32-223 | None |
| A0A5B7CLG8 | 1030-1233 | None |
| A0A6D2I6U0 | 435-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.