DPCstruct | MC10523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 7.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R0U9N3 | 2-102 | AGILLGISGLNSLLEGLYTIDYWQGWLFVALGIIVAGTAAMLVFRVPGAPIVALVAACASLIISAVWVATYHWFNLAAIGLDLVAIY… |
| A0A6I1G4L1 | 2-108 | IIGGVMQALQGLVALFNDTFYVVGEEYLFQFDVTAWGWIHLLLGIVVAVAGFSLLQGATWARVVAIVVASVSILVNFVWMPFYPLWS… |
| A0A239L8C9 | 12-133 | None |
| A0A853AMS8 | 37-158 | None |
| D3Q5J9 | 6-132 | None |
| A0A387HNB3 | 20-142 | None |
| A0A1H1YLE0 | 77-200 | None |
| A0A538MDA9 | 19-141 | None |
| A0A4V3F9R6 | 2-128 | None |
| A0A086E1N7 | 3-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.