DPCstruct | MC10522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D1ABL6 | 2-93 | AWLLELVPPEYRRYGVLRRHPLALARLARQHIEACVAAARQGFRTARADLGGDVPPHGIEALLEVYRREGARLAALAEAVAAVEAEL… |
| A0A6I1G1F5 | 1-130 | MFDEPSPSAPRSGPPGWPNAVPPAGSPGWQVAAASWLLDLCPSEFRGYPSLRRHLVLLVWLAGHHVDAQLVALRQAYRTIRVDLADR… |
| A0A4V2JSI6 | 17-148 | None |
| A0A1X7CA07 | 92-202 | None |
| A0A5R8MDT4 | 105-229 | None |
| A0A7X8B781 | 16-114 | None |
| A0A7W5YD08 | 78-197 | None |
| A0A0D6W5T8 | 2-106 | None |
| A0A4Z1CPT6 | 1-119 | None |
| A0A356FIB6 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.