DPCstruct | MC1052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 233 ± 38 aa |
| Standard deviation of domain lengths | 38.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12543 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D3UL71 | 407-607 | IAMHECALGSVLNAIGLKSYEIDGPEKLLGLKLGGDWIARRDVPTDDTLSALERILENGLNRKVRFEKQEVNRDVIIVRGQFKHVPL… |
| A0A4R5FKH2 | 68-278 | NHSEKLNVETSLYSIKIEETNDIYSPSTQQNYPDSIAYKNVSLKTTLSYLLNTNEILLQTNDEKMFDKTLNLNFKNKSKDSSQTKSI… |
| A0A521FRW3 | 32-276 | None |
| A0A521FRK1 | 144-444 | None |
| A0A3C0ZEB7 | 24-322 | None |
| A0A7Y5VI79 | 1-174 | None |
| A0A2N9L6L5 | 98-321 | None |
| A0A4V5LY75 | 620-855 | None |
| A0A376E407 | 1-169 | None |
| A0A7Y5RDX7 | 2-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.