DPCstruct | MC10519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 250 ± 50 aa |
| Standard deviation of domain lengths | 49.84 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817RV05 | 18-252 | ELIKIVWGDKIEESIFERWSQPFEFSTDERSALIQYEGGPCSVLTTVQAHLLNELIFCRRCLNDWRQASNDEIDLHFLNALVSILHL… |
| A0A7J7EFQ5 | 3-224 | AMSTEIPEDVKLRQSLFGDTVGVFSHDWKEACFRFHDPFSDLAFALQVGKGGARSIQMAVQGFIIKYLLFARKGKDCNLLSLRTISR… |
| A0A662X1V8 | 751-1058 | None |
| A0A1S3V001 | 74-246 | None |
| A0A1I8FC31 | 493-722 | None |
| A0A670IU11 | 223-430 | None |
| A0A5A9N056 | 77-319 | None |
| A0A6P8V6I2 | 234-370 | None |
| A0A6J0IW61 | 17-236 | None |
| A0A1Q9C8R0 | 60-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.