DPCstruct | MC10518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9XHF7 | 32-117 | LASREELLAGEILAELTRARAKFPGKNVTFAALVEEVGELATATFEESADRVRKEAVQVAVMAMRMVLDGDHSFEPWRAEKGLDPL |
| A0A7J4ZRP4 | 14-90 | VSAAHRKFLTDVAEEIQAARKKFPDNGHLLAALVEEVGELATAYLENEGTSRVWDEAKQVACVAARIATEGDSDFFP |
| A0A4V6NR34 | 99-194 | None |
| A0A1P9XTA8 | 7-87 | None |
| E2CBZ2 | 1-88 | None |
| A0A2N5BLD7 | 48-123 | None |
| A0A4Z0MEQ3 | 9-85 | None |
| A0A410NU72 | 96-181 | None |
| A0A1P8UWF3 | 1-86 | None |
| A0A484U4G9 | 317-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.