DPCstruct | MC10516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 202 ± 23 aa |
| Standard deviation of domain lengths | 22.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7JA95 | 44-234 | KDNNWAEDIKRKDSAPDVREILEFYKDKIPAADLIILRQAMYIKKVFLERRNQDVRNMKRDIRDKYGKRGANITNLCTAGYYEKDFN… |
| A0A2H9LDK2 | 21-229 | GENKIKQLVQQFKNGKLAFIQDQETIDLVKKQLESGEWDLCKGYIKDDFLKLLVKMGLTLRELDRLKETKKIQNLKQKINIKFGPRG… |
| A0A5E4HST2 | 65-277 | None |
| A0A1I0NJ69 | 139-328 | None |
| A0A847U835 | 56-292 | None |
| A0A534K5F5 | 5-183 | None |
| A0A662FDU5 | 97-335 | None |
| A0A2V4GU66 | 99-280 | None |
| A0A078B369 | 17-180 | None |
| A0A078AZK7 | 234-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.