DPCstruct | MC10512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 168 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 72.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836D4Y3 | 98-261 | LLRRGELQRESDFMASVDSSWISWGVGVFLLKPLKWTLSNMLGDHKVPAEEVLVAVELLKEKAEEVYRLYQNSPLSSHPVVALSELS… |
| A0A2A2L9X7 | 79-244 | SLSAVVEQLRADGQVTTLSVWRTSHSTWLSWGVSKTTSWFYGREAEAEQFIHLPTIEKQAEQLIRLYETELMDDLEGSSDVVDYRDL… |
| A0A818YPS8 | 86-252 | None |
| A0A0B7NC84 | 532-709 | None |
| C4WX00 | 2-159 | None |
| A0A0V1FPW4 | 71-240 | None |
| A0A0C9MD31 | 515-688 | None |
| A0A7R9CVI6 | 19-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.