DPCstruct | MC10510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 122 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A9NT07 | 5-114 | ERPKSEDCRHMVKIIVDSMREHSLNPTRKDCTVVAKENTDGFPKSFLDKTEEGETIRCGYFSSLNQLKTSIEYLNRGNTLSRLRKPR… |
| A0A3B3RI04 | 262-402 | MRPTLRRAIDAGKRPEAEDRRHMVKVTVDSMREHCLNPTRKDCTAVAKAIIQKYPGSFLDKTEEGETIGCGYFSLLNQLKTRIEYIT… |
| A0A6F9A9R9 | 2-113 | None |
| A0A6P7WMN4 | 119-238 | None |
| A0A0F8CSN9 | 118-242 | None |
| A0A672HZP7 | 289-419 | None |
| A0A498MAI3 | 272-395 | None |
| A0A5A9N753 | 339-477 | None |
| A0A6S7G6F6 | 393-535 | None |
| A0A2I4AKT5 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.