DPCstruct | MC1051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 5.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12788 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A117SLC1 | 1-89 | MHGFSFVTSVNDRHTHIMIGATSLGVAHGVSHIHYYKGTTSWADGHVHYYSGMTGPAVYLADGSHVHSHRGITAMAHHHTHYYSGTD… |
| A0A6I3SSK9 | 76-164 | NIHTHKYSVHTTVNKKHRHCMVGITSPEPDIQSHRHRYSGRTTLNHQHIHYYCGVTGPAVYVSGLGHYHVIEGKTSYDLRHLHFYNG… |
| A0A2A8MMH5 | 37-140 | None |
| A0A355BGD1 | 4-105 | None |
| A0A1H0QRB2 | 8-110 | None |
| I8RIQ6 | 72-176 | None |
| A0A0L0WBQ6 | 66-165 | None |
| A0A0C7Q6I2 | 75-177 | None |
| F6BHH4 | 17-120 | None |
| A0A7C6SZB5 | 14-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.