DPCstruct | MC10508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M8BHG0 | 19-129 | MLEKLIWISAFMLVGARHPGATVGAVEKEYRSEVSSLIAELASAAAAERGLTFDEGMEERLCAYSRAVAHFPTAFKWRNGWFYSLTE… |
| A0A835N4U3 | 203-316 | MLEKLIWISAFMLVGARHPGATVGVVEKEFRSEVSSLIAELASAAAAEKGIVFEEAIEERLCAYSRAVAHFPTAVKEFKWRNGWFYS… |
| A0A7S2T2A0 | 251-364 | None |
| A0A383WC49 | 190-299 | None |
| A0A7S4N1N1 | 1-114 | None |
| A0A7S3CB44 | 2-102 | None |
| A0A7S1D8E4 | 116-239 | None |
| A0A3L6RLK5 | 154-262 | None |
| A0A834L8S1 | 169-261 | None |
| A0A7S2S5D9 | 73-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.