DPCstruct | MC10507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 129 ± 23 aa |
| Standard deviation of domain lengths | 22.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PE91 | 7-127 | VPRELSEVQQNRTLYQPELPPCLQGTTVRVEYGDVAIAADPAGAHVISHAYPHTYGQPLAHFLRKAANVPDAKVISEHPAVRVGIVF… |
| M8BDS6 | 5-122 | MSPLQKHRAEYRPELPPWLQGTAVKVEYGDAAIAADGADAHVIRRAFPHTYGQRLAHFLPKTANAPDATVITEHPAVRVGVVFSGRQ… |
| A0A7G2DS38 | 11-135 | None |
| A0A3L6R2E3 | 1-107 | None |
| A0A445G085 | 1-145 | None |
| A0A7J6DIX9 | 9-127 | None |
| A0A540MIX5 | 1-162 | None |
| A0A1E5UL35 | 1-192 | None |
| A0A843WXV4 | 1-144 | None |
| A0A1W0W449 | 8-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.