DPCstruct | MC1050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF06868- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I3SJQ7 | 4-130 | LTLVLTSAIVNLEVLSKAVRRMGFELLENDFCRYYFGKKRKDYVIRLPGKFDAAIVEMEDGTYRIEADWDGDHVAKYIGRDGEILLK… |
| M5T731 | 2-100 | RLACRRNELAEPVQGTAKLFNSEATGYLVQLPRWRYLLVCQTDSGKVVYDNYKGHWGDQSHLEKLLQSYATEKCKSEARRQGHSVTE… |
| A0A0W8E405 | 4-153 | None |
| A0A6M3K107 | 1-139 | None |
| A0A661F207 | 2-126 | None |
| A0A2V6S9W4 | 7-160 | None |
| A0A7V4JDA9 | 79-186 | None |
| A0A6P0K0Q2 | 33-178 | None |
| A0A5C0DZC7 | 274-420 | None |
| A0A6J4XUH0 | 3-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.