DPCstruct | MC105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1AKA6 | 104-209 | QVIDMGISRYSHLDVARILRKHFLPGTYDILLKNCNSFTDCALYMMCEQRLAWHFRGLDTIGRTVDANGLLRSLLPDRYRPNPLCAD… |
| A0A813E6B9 | 1-103 | VLLELGVSCISGAALFEALWPHFKEGTYDLLRKNCNSFSDAAIFYLMGTQLDPKYKALDRAAASMDSLVGLVQLLSMRNYTPNPKAE… |
| A0A812Q586 | 1130-1243 | None |
| A0A812QR57 | 1-115 | None |
| A0A7S2KT71 | 116-215 | None |
| A0A812WVD7 | 70-165 | None |
| A0A812M0V4 | 26-121 | None |
| A0A813DBE8 | 82-173 | None |
| A0A813GL97 | 69-156 | None |
| A0A7S4RMQ5 | 108-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.