DPCstruct | MC10499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 212 ± 21 aa |
| Standard deviation of domain lengths | 21.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 42.56 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | CL0344- PF12617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9SHL6 | 249-428 | EHTYTPEILLNEPIDAIEIHIQPWRVEEFKRLWQRLLPVIPKLKLLAISFPDCDNLKDYLLALLEWMKPLPQQLVWQADGRPMSGDI… |
| A0A444ZEV2 | 34-264 | ERCYGCGRCLPVCPYDKIREVTYVRDAATTADLLRRDDVDAMEIHTSGRQSAQFKELWCALGDSVENLKLIAVSLPNGGASTISSMN… |
| A0A1T1D669 | 88-276 | None |
| A0A7J6W0R5 | 14-213 | None |
| M0YQ55 | 19-240 | None |
| A0A7J9IKU5 | 2-206 | None |
| A0A067JYN9 | 2-196 | None |
| A0A7J7IIY8 | 249-474 | None |
| A0A834SLZ5 | 102-342 | None |
| A0A4U6TVU4 | 20-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.