DPCstruct | MC10497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3J8J6 | 2-54 | FAVLQQRAAALGITLRNPPPEPTTCCGRGCNGCVWEGFLSAAEYWRQEALLQL |
| A0A542RRH9 | 7-66 | ASAQRMFQLLQQRAANAGITLRNPPPAPTTCCGRGCNGCVWEGFLDAAEYWRQEALLVLE |
| A0A5C7ZIP2 | 17-77 | None |
| A0A2P1NPQ9 | 3-62 | None |
| A0A4R2NFQ3 | 42-102 | None |
| A0A6G8CXZ0 | 5-71 | None |
| A0A557R2D0 | 18-77 | None |
| A0A1I1ZRP3 | 19-93 | None |
| A0A0Q5LRZ7 | 7-68 | None |
| A0A4Q3M0T4 | 4-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.