DPCstruct | MC10490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 196 ± 40 aa |
| Standard deviation of domain lengths | 39.89 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.16 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0039- CL0276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S3M660 | 2-143 | TKGEMVANCADKLFLQKIVANSMSCSSPAKARYKKLSPRHCGYCVPCLIRRASLEVGLDGDDETLYTVEDLKGHILASDQPEGEHVR… |
| A0A5J4Q9N2 | 16-192 | SYRKGKDCLVTHTKRYRTKIGIETSISNPYEFFTKGEMVFNCKNIKLLEQLVAISNSCGKRGHRINWETPTASHCGICMPCTYRRAS… |
| A0A373KQP1 | 500-673 | None |
| A0A537GC75 | 12-188 | None |
| A0A1Q9V7W4 | 1-141 | None |
| S9R6S4 | 216-449 | None |
| A0A554J6J0 | 311-495 | None |
| A0A7D5C0S6 | 42-268 | None |
| A0A841PED0 | 108-374 | None |
| A0A0Q8YMW8 | 179-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.