DPCstruct | MC1049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 56 ± 2 aa |
| Standard deviation of domain lengths | 2.39 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 65.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5K656 | 1-49 | MSDQLKNELAKDLGFYDTVQKEGWGGIKAKDAGNMVKRAIQIAEQAAQK |
| A0A6I3SB41 | 1-56 | MTRRKPVMSDRLKYELAQELGFADVVERDGWGGITTRDAGRLVRAAIERAERNLAS |
| A0A1H0NJM9 | 3-57 | None |
| G4HP07 | 23-79 | None |
| A0A0Q7J9B4 | 1-58 | None |
| A0A1N7MI98 | 85-142 | None |
| A0A644U3T7 | 24-80 | None |
| A0A7C6CZ69 | 1-57 | None |
| A0A6I5SRD1 | 1-58 | None |
| A0A4R6HD02 | 54-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.