DPCstruct | MC10487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 54.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368QLW3 | 2-108 | HEMTAAQVLQKQLFDAHEPNLLDENDMHIFGSKPMADPLDLVCCSTCKKPVKASQYAVHTERCSSGKVNTNDSMGVDHESPTKPRKK… |
| A0A2K1YN45 | 1-118 | MVCSIGNGRMAVMARLLAAGSLLQNSAEEVSQQKLATQYICRELHEADEPNLLDEEDMHVFGLMPMTDPLDLVCCNACKKPVKASQY… |
| U5D3Q0 | 1-129 | None |
| A0A2T7EHL2 | 3-104 | None |
| A0A7J9I9N6 | 1-117 | None |
| A0A2P5E408 | 1-124 | None |
| A0A7J6EC92 | 1-119 | None |
| A0A5N6LAH6 | 54-168 | None |
| A0A6N2K6R5 | 66-187 | None |
| A0A453K1Z4 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.