DPCstruct | MC10486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 4.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 68.59 |
| Pfam Score | 94.17 |
| Assigned Pfam label(s) | CL0023- CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2BKG9 | 179-246 | DWALHWINDRTSTFGERLVAFAAVEGIFFSGSFASIYWLKKRGLMPGLTYSNELISRDEGLHCTFACL |
| A0A2K1YN21 | 2-69 | SKEKHRLFNAIENIPCRLVAFSCVEGVFFSESFCTIFWLKKRGLMPVLTFSNELISRDEGLHCDFACL |
| A0A0D0CU58 | 47-118 | None |
| A0A0D0D7Q6 | 40-111 | None |
| A0A1S4AIV5 | 40-107 | None |
| A0A284S821 | 40-107 | None |
| A0A068UMH0 | 83-150 | None |
| A0A7J9FUS1 | 33-100 | None |
| A0A0D0D8C0 | 2-70 | None |
| A0A7R9PU46 | 33-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.