DPCstruct | MC10485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 179 ± 30 aa |
| Standard deviation of domain lengths | 29.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.90 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0028- PF18117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9SU72 | 186-372 | FDIVPRIMLARKASVEETLPHVLAQLDPRKSSVQESEQRITEFYTRVMRDTSTVANQAVCELTGSAEAFLETLSSFLELSPYRPAGT… |
| A0A2K1YAC6 | 2-136 | TLSLPRISLTPLSAIEQQLQQVLDFFNPKSKFYKQEHADQVPGFFVIVMENASSVARYAACNTMGSPNLLLETLSSFIKLSPYTPLG… |
| A0A2G3C9N9 | 186-370 | None |
| A0A6P6G7L2 | 1-182 | None |
| A0A1D1XGX1 | 1-189 | None |
| A0A2H5Q178 | 317-530 | None |
| A0A822YVG0 | 3-156 | None |
| A0A6J5XH51 | 1-134 | None |
| A0A251PA73 | 195-416 | None |
| A0A068V2A0 | 651-871 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.