DPCstruct | MC10484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 19.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1WU37 | 2-139 | RYKLEGHRFEKSTTKVKGKQSLVVNSTTTRVPTGVKRNDRATPSTFQKGERKKPSLKERQEKVYPFPDSDISRMLDDLLEANIIELP… |
| A0A5D3E7P5 | 1-153 | MELSIASRGAKDFPIPEVRKDRKETKGAKKIVKSIVKESMVVSMSPLKFSKRKEVKVEKKDDGSERRRLTLKEIQEKVYPFPDSYTA… |
| A0A5A7VFA5 | 42-226 | None |
| A0A5A7VNX1 | 10-165 | None |
| A0A5D3DWV0 | 41-185 | None |
| A0A1D6I2S4 | 752-921 | None |
| A0A843WYB8 | 348-522 | None |
| A0A6V7PH84 | 217-401 | None |
| A0A2I0X5V8 | 1-155 | None |
| A0A5A7ST79 | 42-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.