DPCstruct | MC10481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6KI04 | 4-98 | DVIVSTAADISIAILSLALLLTAVRVVKGPTLPDRVLSLDMLVAVAMGFIVVIAIRSGFTLYIDIAIALGLVGFLATVAFARFIRSS… |
| A0A455V5Y7 | 1-70 | METVILISQVIMGLALVLTFVRVVRGPSLPDRVVALELFSTTVVGLVGVYAIQSGVSSFLDAAIVIALMG |
| A0A4R7RW29 | 11-105 | None |
| A0A3M0Y5F0 | 32-118 | None |
| A0A5E8H4Q8 | 6-100 | None |
| A0A285VUL2 | 3-88 | None |
| A0A5Q2W1G0 | 3-109 | None |
| S3B3I0 | 29-120 | None |
| A0A1H9ND97 | 21-133 | None |
| A0A517ZQK8 | 18-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.