DPCstruct | MC1048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 277 ± 48 aa |
| Standard deviation of domain lengths | 47.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12055 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534R8K2 | 251-561 | MQTSCGWFFDELTGVEPVLVLRHAARAIELARNLGRDYENGLVARLAPARSNLAGRENGADLYRRVVLRARATPGRVAATAAMMQLI… |
| A0A3N5WWA3 | 2-258 | RLTSQLTWDSQEFSFAVLHIGDHNLISGVRQGGREERCCSAVREAFERNDIPEVIRVLDRDFAEYRYTLRHLFRDEQRMTLSKILDP… |
| A0A7V1BZF1 | 36-303 | None |
| A0A6G3Z8G3 | 24-297 | None |
| A0A2N1RAX4 | 104-447 | None |
| A0A2U3QJD0 | 1-187 | None |
| A0A3B9YPQ0 | 460-725 | None |
| A0A0S6VWM8 | 679-972 | None |
| A0A832H3I1 | 43-373 | None |
| A0A2V2MPM0 | 408-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.