DPCstruct | MC10477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Standard deviation of domain lengths | 13.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1RY89 | 15-148 | AASMMLAVGAHAKVTPDELKQLDDKLTPMGAERPGSKDGQIPAWSGKWLGVPAGVQWKRGERYPDPYAAEKPLAVITAQNLAQYADH… |
| A0A1I8A509 | 2-113 | GAEKAGNADGSITAWQPLSTTAGSVDAKGFLSDPYGNDKPKFTITAQNVDQYKDKLSPGQLAMFKRYPDTFKLPVYPTQRGSTVPDS… |
| A0A1Y1SHA6 | 418-540 | None |
| A0A5C9CTZ5 | 1-152 | None |
| A0A317ED84 | 14-153 | None |
| A0A6J5IZ52 | 1-145 | None |
| A0A418WH58 | 361-495 | None |
| A0A1I1YRR4 | 16-151 | None |
| A0A2E7E7P0 | 42-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.