DPCstruct | MC10475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 302 ± 24 aa |
| Standard deviation of domain lengths | 23.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3GAR7 | 7-320 | TDARSAKDWLILLPLINTPVAHAELRHAMRALASSDLAVLESLKALEILRESVHDVQFALLTEYAAKPLPLNTHEQAQWLAACDLWG… |
| A0A4P0THT9 | 7-330 | HLSLRVPTPTQQNLSFCDATPKDLRHWLAHLPKANLGETARQLYQGLIELNQLVLPAEARLQLLELFRPEVHFVCSHLERHFLNQAI… |
| A0A2Z3R0Z8 | 3-317 | None |
| A0A6N4DL34 | 10-284 | None |
| H8GHU6 | 1-284 | None |
| A0A381ESC0 | 12-298 | None |
| A0A2K8UFW6 | 8-262 | None |
| A0A2K8U7N1 | 21-323 | None |
| A0A348N1X0 | 149-430 | None |
| A0A1X9NLU6 | 226-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.