DPCstruct | MC10474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4N8L9 | 101-165 | FYRTDKLDEQRFATLREALARRLDTLSETPPIPFRRQNHGDYLIPSLNLRPELAPGENGLAIHVK |
| A0A4P0TEA4 | 12-81 | CRRSSSTAPAGSTPGRFAALGEQLGQRLDELWRTAPIPFRRQNGGDYAIPALTLRDEIAPGRVGFAAHLA |
| A0A6J5AMP1 | 130-192 | None |
| U2L558 | 1-66 | None |
| V6AIK8 | 57-121 | None |
| A0A4R8LGG0 | 45-110 | None |
| A0A6M3V3M1 | 2-56 | None |
| A0A0A8FNA8 | 22-87 | None |
| A0A3N0E9S4 | 100-163 | None |
| A0A7U4URS5 | 33-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.