DPCstruct | MC10473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 248 ± 44 aa |
| Standard deviation of domain lengths | 43.59 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485ID81 | 3-249 | IQSYGDTALDYYNVRLMGGTAFNPGAIPPGGDYWTAFANYSPRVQLLAWNQPMPYWFFANGRRFWIVVKVSTIYESAGAGFILPPCP… |
| A0A3D1JNC4 | 2-278 | LKACLVDGYGAKAAAGWTQPFTGTGLAAFRPAAGNRHYLWVDDTNATAARVRGFEEMTDISTGTGPFPTDAQLSGGCYNIKSNTASS… |
| E6SKJ0 | 196-417 | None |
| A0A1G3M1U2 | 247-451 | None |
| A0A244CUG8 | 1-306 | None |
| A0A0S4WTB5 | 16-224 | None |
| A0A2C9ZEM9 | 1-316 | None |
| A0A349MLG0 | 1-304 | None |
| A0A848NVY5 | 73-306 | None |
| A0A7Y8GMZ0 | 46-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.