DPCstruct | MC10472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4ZFT9 | 223-384 | RLATSLIAKGAATKEKSIHGKSSDWGPMAGYIPYDQDLSKLHGSKVEVDWGNRENKRTIEQKDEYGNPSVVKLYLELDIDRQRELEI… |
| A0A485HRB3 | 9-167 | SNMPCACRRWPGRRIPSLAFARLKRIVTTLIEEGFPTKGFSVKGKSSNWGPQAGFICVDQHLSKRENRDTAEIRKLNLAVAKGMDGG… |
| A0A2G2AXP1 | 237-385 | None |
| A0A1J9WPE4 | 530-679 | None |
| X6Q548 | 56-205 | None |
| A0A7Y4EG91 | 95-253 | None |
| A0A6L5LR02 | 49-198 | None |
| E0WTE7 | 2-163 | None |
| A0A2U8I3U0 | 120-270 | None |
| A0A859PW85 | 7-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.