DPCstruct | MC10471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 202 ± 34 aa |
| Standard deviation of domain lengths | 34.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377DH90 | 25-237 | INELTSQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQDAGFTMQKRKGFGRKREMLCGV… |
| A0A485FQK2 | 1-250 | MPLECLPQLDARVDAWFLDGFAPAKNPDMWSPVLFAELARLSAPQATLGTFTSAGFVRRGLVEAGFAMQRVPGYGQKREMLSGTYQG… |
| A0A6N3UGY6 | 1-197 | None |
| A0A2X1ARA4 | 1-196 | None |
| A0A0B8PFD9 | 18-199 | None |
| A0A3D1G6A4 | 100-304 | None |
| A0A3S4EAW0 | 4-148 | None |
| A0A090PC19 | 98-312 | None |
| A0A556A7L3 | 319-535 | None |
| A0A2E0Y4N2 | 259-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.