DPCstruct | MC1047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S5ZK89 | 10-119 | FKKILSNKKLALLGDAIVNFIASAALSLQKGATGIKVSGKILQSVYSLSILATLDIEGIDKGEAVEAFLAYAWLNNMFTCEDGVKVV… |
| A0A3M1V9F2 | 30-165 | LERILSSKSIREVVKSTDLAQIGDFLTNFVYTTMRIGIKGKGGSIHVWDRALTNAARDTGLIRYFPNRFKRDKIADGVEALIAFAYF… |
| C5A5J1 | 95-220 | None |
| A0A832CDC9 | 6-113 | None |
| A0A7C4CRM8 | 58-179 | None |
| A0A497HL99 | 1-110 | None |
| A0A7C2VXX2 | 12-136 | None |
| A0A7J2MN61 | 3-114 | None |
| A0A444L6N8 | 37-164 | None |
| A0A497GLT1 | 4-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.