DPCstruct | MC10469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4BPP6 | 25-124 | AERDFFADAAQRCRLTGIVEIADGGRTMIVDGEGEDSGSGRVRLNDLECIIDAVDTPASVKELMYSTRSLDGRQSGDWEGVSASWSY… |
| A0A4Q5A2U7 | 160-252 | LSSVYERCSSTSSRIKLSNDEKSITIEESQYSSLEALECIADATSMPDATFSNIEQTTGLDGRQSAEWGPYKASWSFNANRKSNAFQ… |
| A0A3E2UC60 | 343-437 | None |
| A0A1C6IRX5 | 161-265 | None |
| A0A0M8XPA6 | 14-108 | None |
| A0A2W1Q2X4 | 1-73 | None |
| A0A163R7E1 | 52-155 | None |
| A0A7L7W2K3 | 49-144 | None |
| A0A1X6X604 | 4-96 | None |
| A0A810Q3H6 | 46-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.