DPCstruct | MC10468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 116 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 94.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2GYS7 | 19-143 | SFQYIEDSVFSSCVFDTKDAFWHAKNIIIKDSVLKGEYLAWYCENVTFDNCTIIGTQPLCYCKKLKLMNCRMIDCDLSFEKSEVEAT… |
| A0A4Q5A0C9 | 3-126 | TNTITQQLLTGERALFQAQDLAIRDCVFENGESPLKESRGITFENCTIESLQGLCYVDGLTMRDCRLINTTRAFEYCTDIDAQSTTR… |
| A0A1H9Q475 | 29-164 | None |
| A0A3A8ZI45 | 129-232 | None |
| A0A3C1J210 | 9-185 | None |
| A0A0R1KD95 | 10-100 | None |
| A0A0R2M1C6 | 145-267 | None |
| A0A173RB01 | 1-81 | None |
| A0A0R1JXU6 | 96-219 | None |
| A0A267M839 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.