DPCstruct | MC10467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6UKA2 | 1-104 | MAGYNYKLNMSNNAVEAYEKGAKPYNEWSLAEIIDKVLDIYDPEEHAFDINKLVNTPLKAVKLCVLSYSSWHHTTKKYKETEFYFVD… |
| A0A2N3QTK8 | 1-105 | MTVNANRGYVGWSMSVRAEQAYESGEMPKSKWTKQAMLAAIHDWLDEHHIQLTDKQARNLSKLPRMVMFENLFCASSWHHTSKQFNK… |
| C7GYW0 | 1-122 | None |
| A0A412LHK8 | 1-104 | None |
| A0A2T5F0Y1 | 5-87 | None |
| A0A6Z8WUE9 | 2-100 | None |
| A0A414W5I5 | 1-101 | None |
| A0A3D5LN57 | 2-101 | None |
| A0A7H9CGC2 | 3-104 | None |
| A0A7V3AA19 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.