DPCstruct | MC10466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A425W7C1 | 3-131 | QYQKMAGQHLQEMRGQEERTNKKLLALENVIGYTCSASFLLMILAASFAVANITWRIVLIAAGCLIFLIGLVSCLKLEHDAGYYKCP… |
| A0A2N3QS71 | 2-95 | LVVGGVMDVLEIALLAIWIMIGNWVPFVIGLVPIVLLGVGISVYYFRSVAYLCPNCHTVFRPKFSRMFWSAHTPYSRKLVCPNCRYD… |
| A0A660Z320 | 40-142 | None |
| A0A497RP38 | 5-100 | None |
| A0A514XV77 | 24-133 | None |
| A0A1Y4T0J1 | 169-273 | None |
| A0A1C6H808 | 2-107 | None |
| C8P507 | 190-297 | None |
| A0A0R2D424 | 87-188 | None |
| A0A7Z7P553 | 49-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.