DPCstruct | MC10463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2AIR5 | 2-109 | AKNVLEGKIKGYKNHPQLERFKAQDNPLDYINAYLLDIYDEARARGYRFSREKIGLLKNNLKDIKVSNGQIDYEFEHLLKKLVERDK… |
| A0A2A9EBN2 | 34-150 | TRGYRNHPQLERFVATPQPIVYVGAYLAGLAVEADARGYRFDRTRIDELPADLAAFDGAMEVTTGQLALEWRHLLAKLDARSPDVAA… |
| A0A2N9LA53 | 26-148 | None |
| A0A0J0XHS4 | 34-144 | None |
| A0A1Q6UBI8 | 26-133 | None |
| A0A7X6DL72 | 2-102 | None |
| I0UT43 | 75-192 | None |
| A0A101ESG5 | 10-102 | None |
| A0A847DZE0 | 6-99 | None |
| A0A0Q0UDG4 | 114-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.