DPCstruct | MC10461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 13.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.47 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | PF10765- PF18066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2U8Y7 | 37-145 | KQLQQFDSMDMEKRNEYIALEVMNWSRNTVEPPFYITQKDYLKVDSFQPAQEIGSAFLVFNYVLVEDKTSLVACGSGKGRFWAVYYE… |
| A0A6M3Y596 | 5-114 | KMDLNKWSAEKVMGWHEDNYAPWGSSGYGPSWVQEDGAQISQGSWEPLTNMNQAMMVVEKMRGKGFAFEFENGGDNAEYHAVFLAVG… |
| A0A150D4M2 | 1-119 | None |
| A0A357SYX6 | 7-128 | None |
| A0A2A8WB03 | 7-132 | None |
| A0A2M6ZV46 | 3-116 | None |
| A0A2L1U087 | 12-106 | None |
| A0A3B8VPF2 | 39-154 | None |
| A9I8Q2 | 1-129 | None |
| X4ZWQ2 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.