DPCstruct | MC10460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 201 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A640VUG3 | 17-204 | TDNAARVFDREAAHLPGTWAEALTCHRQQIADHHAAMLTNDFETAMHVRQEAYLLASKLNGGRHGILAGEDAPGCKLDAQASAAEGE… |
| A0A6M3XWF8 | 58-266 | DLRDAAVLRMAPDLPADQAGLDTVAREAFEAFHAAVVIGDEAAMMAASIRYDAVVWKLNGGAFFACEAGNEAVSPRLRARLAAAPGA… |
| A0A1H9QC62 | 623-839 | None |
| A0A368ALV8 | 21-229 | None |
| J9S0P1 | 2-190 | None |
| Q08L08 | 21-228 | None |
| A0A103ELM0 | 17-216 | None |
| A0A220WPE6 | 18-222 | None |
| A0A1B9VNK3 | 3-177 | None |
| W7WYL8 | 2-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.