DPCstruct | MC10459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3XRT2 | 1-74 | MCKWNNTKVLEVKGVPRDIDSCIFNLVKVLNEHYKTTVACCCGHEKQPSRISFDDGTEMILCTYDQAQQISKLF |
| A0A0F9DLV7 | 2-71 | LRITTTSGKIGSADPCIAELVQALNDAGFETIASCCGHGHRPGNIVLKDGREFVIARNWEEARQIDRLFP |
| A0A2E5AD75 | 185-251 | None |
| A0A0F9EKC4 | 4-76 | None |
| T5KUG8 | 10-75 | None |
| A0A3D6C6C5 | 8-82 | None |
| A0A2W4T084 | 6-71 | None |
| A0A7C1L3W2 | 1-58 | None |
| A0A7C1KVW6 | 11-80 | None |
| A0A6N3UE69 | 12-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.