DPCstruct | MC10458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 215 ± 23 aa |
| Standard deviation of domain lengths | 23.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0Z8X6 | 37-215 | SNNKEVIKFYPTISKATANNTFSEPLNKEKIGEQILTLKDDKTQINFFKSTYNNQDTVTVYKYQLRQDAGRLLYSSPTNATQIIWHA… |
| E6MJC7 | 80-296 | VLVYVSMYGMLASQLNQMEHHAGVLSGANANVFSYTDDIFAKSYSSADEILKNTKLDAGYREFYRFEDSHAVSVFYQKPAPKHVKKG… |
| A0A1Y4GAH0 | 193-408 | None |
| A0A1G6CA62 | 1-253 | None |
| A0A3A9A4L5 | 11-217 | None |
| A0A350WJV9 | 1-230 | None |
| F2N6V7 | 28-274 | None |
| E6MJC8 | 77-272 | None |
| A0A2S6HSC3 | 116-338 | None |
| W1Q6C0 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.