DPCstruct | MC10457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 225 ± 26 aa |
| Standard deviation of domain lengths | 25.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N0BH29 | 7-208 | KKLNQLHIEAEDLWRVPAKDGWQKSPVSPMDILKLFKGIWIKEGYTLRAYIFRQGLNGNGVVWALPESEFPDVDECEWLDTLKTPKP… |
| A0A3E5A3E0 | 3-197 | YSQFIHVLFPEIQIIRDWYISVRLYSDGKNAIGDESYFYVANSKNSATYFDMESNSIKFEGERDFLIWKYVVMPKSKRAIWELYLLM… |
| A0A2N5YXJ7 | 20-262 | None |
| A0A133QIM5 | 898-1110 | None |
| A0A1Y4FAU9 | 184-430 | None |
| A0A1V5V654 | 111-366 | None |
| A0A255R5D9 | 48-299 | None |
| A0A7J5GVU0 | 252-457 | None |
| A0A379EZ05 | 569-765 | None |
| A0A1N7JFH9 | 19-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.