DPCstruct | MC10455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19383 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R8WX79 | 2-131 | FDAAFLMLNRIAQDQLPLSAGLTWFDALTDEEQRAAMNELHLYVHQSHPTPTMVQQAVATAPIKRGATPLALLRAFPFHIALPKIIS… |
| A0A5A8BG34 | 1-142 | MSTREIEIKLNQIRQGVIPDAAGQAWFAALEAAEQKSVLYQLNFICQQAGPTTADVLPAIEHAGLKSTFTPCVMLQRGKLREASAKA… |
| A0A2N7L3L8 | 1-125 | None |
| A0A3N1PDT4 | 151-274 | None |
| A0A7D5N878 | 2-141 | None |
| A0A0M4DEB6 | 1-130 | None |
| A0A812M661 | 1-139 | None |
| A0A0N1GJM1 | 52-176 | None |
| A0A327NHR3 | 7-125 | None |
| A0A4Y3RS28 | 12-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.